Anti-NNT Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA004829
Article Name: Anti-NNT Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004829
Supplier Catalog Number: HPA004829
Alternative Catalog Number: ATA-HPA004829-100,ATA-HPA004829-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NNT
nicotinamide nucleotide transhydrogenase
Anti-NNT
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 23530
UniProt: Q13423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NNT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-NNT antibody. Corresponding NNT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell lines HeLa and U-251MG using Anti-NNT antibody. Corresponding NNT RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in human cell line RH-30.
HPA004829
HPA004829
HPA004829