Anti-FLNB
Artikelnummer:
ATA-HPA004886
- Bilder (8)
| Artikelname: | Anti-FLNB |
| Artikelnummer: | ATA-HPA004886 |
| Hersteller Artikelnummer: | HPA004886 |
| Alternativnummer: | ATA-HPA004886-100,ATA-HPA004886-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ABP-278, FH1, FLN1L, LRS1, TABP, TAP |
| filamin B, beta |
| Anti-FLNB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2317 |
| UniProt: | O75369 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FLNB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human colon, kidney, pancreas and testis using Anti-FLNB antibody HPA004886 (A) shows similar protein distribution across tissues to independent antibody HPA004747 (B). |
|
|
Immunohistochemical staining of human pancreas using Anti-FLNB antibody HPA004886. |
|
|
Immunohistochemical staining of human testis using Anti-FLNB antibody HPA004886. |
|
|
Immunohistochemical staining of human colon using Anti-FLNB antibody HPA004886. |
|
|
Immunohistochemical staining of human kidney using Anti-FLNB antibody HPA004886. |
|
|
HPA004886-100ul |
|
|
HPA004886-100ul |
|
|
HPA004886-100ul |
Produktgarantie und fachkundiger Support
