Anti-FLNB

Product Overview

• Article Name: Anti-FLNB
• Biozol Catalog Number: ATA-HPA004886
• Supplier Catalog Number: HPA004886
• Alternative Catalog Number: ATA-HPA004886-100,ATA-HPA004886-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ABP-278, FH1, FLN1L, LRS1, TABP, TAP

Product Description

filamin B, beta

Additional Information

Anti-FLNB

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 2317
• UniProt: O75369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FLNB
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemical staining of human colon, kidney, pancreas and testis using Anti-FLNB antibody HPA004886 (A) shows similar protein distribution across tissues to independent antibody HPA004747 (B).

Immunohistochemical staining of human pancreas using Anti-FLNB antibody HPA004886.

Immunohistochemical staining of human testis using Anti-FLNB antibody HPA004886.

Immunohistochemical staining of human colon using Anti-FLNB antibody HPA004886.

Immunohistochemical staining of human kidney using Anti-FLNB antibody HPA004886.

HPA004886-100ul

HPA004886-100ul

HPA004886-100ul