Anti-IRF3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004895
Artikelname: Anti-IRF3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004895
Hersteller Artikelnummer: HPA004895
Alternativnummer: ATA-HPA004895-100,ATA-HPA004895-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IRF3
interferon regulatory factor 3
Anti-IRF3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3661
UniProt: Q14653
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IRF3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IRF3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human cell line A-549.
HPA004895
HPA004895
HPA004895