Anti-IRF3

Catalog Number: ATA-HPA004895
Article Name: Anti-IRF3
Biozol Catalog Number: ATA-HPA004895
Supplier Catalog Number: HPA004895
Alternative Catalog Number: ATA-HPA004895-100,ATA-HPA004895-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IRF3
interferon regulatory factor 3
Anti-IRF3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 3661
UniProt: Q14653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IRF3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IRF3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human cell line A-549.
HPA004895-100ul
HPA004895-100ul
HPA004895-100ul