Anti-HTR1E

Artikelnummer: ATA-HPA004931
Artikelname: Anti-HTR1E
Artikelnummer: ATA-HPA004931
Hersteller Artikelnummer: HPA004931
Alternativnummer: ATA-HPA004931-100,ATA-HPA004931-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 5-HT1E
5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled
Anti-HTR1E
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3354
UniProt: P28566
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HTR1E
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and HTR1E over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424479).
HPA004931-100ul
HPA004931-100ul
HPA004931-100ul