Anti-HTR1E Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA004931
Article Name: Anti-HTR1E Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004931
Supplier Catalog Number: HPA004931
Alternative Catalog Number: ATA-HPA004931-100,ATA-HPA004931-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: 5-HT1E
5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled
Anti-HTR1E
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3354
UniProt: P28566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HTR1E
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and HTR1E over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424479).
HPA004931
HPA004931
HPA004931