Anti-PTGDS Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004938
Artikelname: Anti-PTGDS Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004938
Hersteller Artikelnummer: HPA004938
Alternativnummer: ATA-HPA004938-100,ATA-HPA004938-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: L-PGDS, PGDS
prostaglandin D2 synthase 21kDa (brain)
Anti-PTGDS
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 5730
UniProt: P41222
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTGDS
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human cerebral cortex shows strong positivity in neurons.
Immunohistochemical staining of human heart shows strong positivity in cardiomyocytes.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Western blot analysis in human testis tissue.
HPA004938
HPA004938
HPA004938