Anti-PTGDS Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA004938
- Images (9)
| Article Name: | Anti-PTGDS Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA004938 |
| Supplier Catalog Number: | HPA004938 |
| Alternative Catalog Number: | ATA-HPA004938-100,ATA-HPA004938-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | L-PGDS, PGDS |
| prostaglandin D2 synthase 21kDa (brain) |
| Anti-PTGDS |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5730 |
| UniProt: | P41222 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTGDS |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in neurons. |
|
|
Immunohistochemical staining of human heart shows strong positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in human testis tissue. |
|
|
HPA004938 |
|
|
|
|
|
HPA004938 |
|
|
HPA004938 |
Product Guarantee and Expert Support
