Anti-SLCO1B3

Artikelnummer: ATA-HPA004943
Artikelname: Anti-SLCO1B3
Artikelnummer: ATA-HPA004943
Hersteller Artikelnummer: HPA004943
Alternativnummer: ATA-HPA004943-100,ATA-HPA004943-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: OATP1B3, OATP8, SLC21A8
solute carrier organic anion transporter family, member 1B3
Anti-SLCO1B3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 28234
UniProt: Q9NPD5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLCO1B3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry analysis in human liver and kidney tissues using Anti-SLCO1B3 antibody. Corresponding SLCO1B3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SLCO1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412714).
HPA004943-100ul
HPA004943-100ul
HPA004943-100ul