Anti-SLCO1B3
Artikelnummer:
ATA-HPA004943
- Bilder (9)
| Artikelname: | Anti-SLCO1B3 |
| Artikelnummer: | ATA-HPA004943 |
| Hersteller Artikelnummer: | HPA004943 |
| Alternativnummer: | ATA-HPA004943-100,ATA-HPA004943-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OATP1B3, OATP8, SLC21A8 |
| solute carrier organic anion transporter family, member 1B3 |
| Anti-SLCO1B3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 28234 |
| UniProt: | Q9NPD5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLCO1B3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemistry analysis in human liver and kidney tissues using Anti-SLCO1B3 antibody. Corresponding SLCO1B3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLCO1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412714). |
|
|
|
|
|
HPA004943-100ul |
|
|
HPA004943-100ul |
|
|
HPA004943-100ul |
Produktgarantie und fachkundiger Support
