Anti-SLCO1B3 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA004943
Article Name: Anti-SLCO1B3 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA004943
Supplier Catalog Number: HPA004943
Alternative Catalog Number: ATA-HPA004943-100,ATA-HPA004943-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OATP1B3, OATP8, SLC21A8
solute carrier organic anion transporter family, member 1B3
Anti-SLCO1B3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 28234
UniProt: Q9NPD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLCO1B3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry analysis in human liver and kidney tissues using Anti-SLCO1B3 antibody. Corresponding SLCO1B3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SLCO1B3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412714).
HPA004943
HPA004943
HPA004943