Anti-PRMT5 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005525
Artikelname: Anti-PRMT5 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005525
Hersteller Artikelnummer: HPA005525
Alternativnummer: ATA-HPA005525-100,ATA-HPA005525-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HRMT1L5, SKB1, SKB1Hs
protein arginine methyltransferase 5
Anti-PRMT5
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10419
UniProt: O14744
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRMT5
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PRMT5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA005525
HPA005525
HPA005525
HPA005525
HPA005525