Anti-PRMT5 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005525
- Images (9)
| Article Name: | Anti-PRMT5 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005525 |
| Supplier Catalog Number: | HPA005525 |
| Alternative Catalog Number: | ATA-HPA005525-100,ATA-HPA005525-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HRMT1L5, SKB1, SKB1Hs |
| protein arginine methyltransferase 5 |
| Anti-PRMT5 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10419 |
| UniProt: | O14744 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRMT5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts. |
|
|
Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PRMT5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA005525 |
|
|
HPA005525 |
|
|
HPA005525 |
|
|
HPA005525 |
|
|
HPA005525 |
Product Guarantee and Expert Support
