Anti-TM9SF2
Artikelnummer:
ATA-HPA005657
- Bilder (7)
| Artikelname: | Anti-TM9SF2 |
| Artikelnummer: | ATA-HPA005657 |
| Hersteller Artikelnummer: | HPA005657 |
| Alternativnummer: | ATA-HPA005657-100,ATA-HPA005657-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P76 |
| transmembrane 9 superfamily member 2 |
| Anti-TM9SF2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9375 |
| UniProt: | Q99805 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TM9SF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong endosomal positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong endosomal positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong endosomal positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate to strong endosomal positivity in glandular cells. |
|
|
HPA005657-100ul |
|
|
HPA005657-100ul |
|
|
HPA005657-100ul |
Produktgarantie und fachkundiger Support
