Anti-TM9SF2
Catalog Number:
ATA-HPA005657
- Images (7)
| Article Name: | Anti-TM9SF2 |
| Biozol Catalog Number: | ATA-HPA005657 |
| Supplier Catalog Number: | HPA005657 |
| Alternative Catalog Number: | ATA-HPA005657-100,ATA-HPA005657-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | P76 |
| transmembrane 9 superfamily member 2 |
| Anti-TM9SF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 9375 |
| UniProt: | Q99805 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TM9SF2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong endosomal positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong endosomal positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong endosomal positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate to strong endosomal positivity in glandular cells. |
|
|
HPA005657-100ul |
|
|
HPA005657-100ul |
|
|
HPA005657-100ul |
Product Guarantee and Expert Support
