Anti-SEPT6
Artikelnummer:
ATA-HPA005665
- Bilder (7)
| Artikelname: | Anti-SEPT6 |
| Artikelnummer: | ATA-HPA005665 |
| Hersteller Artikelnummer: | HPA005665 |
| Alternativnummer: | ATA-HPA005665-100,ATA-HPA005665-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0128, MGC16619, MGC20339, SEP2, SEPT2 |
| septin 6 |
| Anti-SEPT6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23157 |
| UniProt: | Q14141 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSEL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SEPT6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in reaction center cells. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402410) |
|
|
|
|
|
HPA005665-100ul |
|
|
HPA005665-100ul |
|
|
HPA005665-100ul |
Produktgarantie und fachkundiger Support
