Anti-SEPT6
Catalog Number:
ATA-HPA005665
- Images (7)
| Article Name: | Anti-SEPT6 |
| Biozol Catalog Number: | ATA-HPA005665 |
| Supplier Catalog Number: | HPA005665 |
| Alternative Catalog Number: | ATA-HPA005665-100,ATA-HPA005665-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0128, MGC16619, MGC20339, SEP2, SEPT2 |
| septin 6 |
| Anti-SEPT6 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 23157 |
| UniProt: | Q14141 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SEPT6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in reaction center cells. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402410) |
|
|
|
|
|
HPA005665-100ul |
|
|
HPA005665-100ul |
|
|
HPA005665-100ul |
Product Guarantee and Expert Support
