Anti-SEC16A
Artikelnummer:
ATA-HPA005684
- Bilder (6)
| Artikelname: | Anti-SEC16A |
| Artikelnummer: | ATA-HPA005684 |
| Hersteller Artikelnummer: | HPA005684 |
| Alternativnummer: | ATA-HPA005684-100,ATA-HPA005684-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0310, p250 |
| SEC16 homolog A (S. cerevisiae) |
| Anti-SEC16A |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 9919 |
| UniProt: | O15027 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SEC16A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes. |
|
|
HPA005684-100ul |
|
|
|
|
|
HPA005684-100ul |
|
|
HPA005684-100ul |
Produktgarantie und fachkundiger Support
