Anti-SEC16A
Catalog Number:
ATA-HPA005684
- Images (6)
| Article Name: | Anti-SEC16A |
| Biozol Catalog Number: | ATA-HPA005684 |
| Supplier Catalog Number: | HPA005684 |
| Alternative Catalog Number: | ATA-HPA005684-100,ATA-HPA005684-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0310, p250 |
| SEC16 homolog A (S. cerevisiae) |
| Anti-SEC16A |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 9919 |
| UniProt: | O15027 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SEC16A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum & the Golgi apparatus. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes. |
|
|
HPA005684-100ul |
|
|
|
|
|
HPA005684-100ul |
|
|
HPA005684-100ul |
Product Guarantee and Expert Support
