Anti-RNASE7 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005690
Artikelname: Anti-RNASE7 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005690
Hersteller Artikelnummer: HPA005690
Alternativnummer: ATA-HPA005690-100,ATA-HPA005690-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RNASE7
ribonuclease, RNase A family, 7
Anti-RNASE7
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 84659
UniProt: Q9H1E1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RNASE7
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western blot analysis in control (vector only transfected HEK293T lysate) and rNASE7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410028).
HPA005690
HPA005690
HPA005690