Anti-RNASE7 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005690
- Images (6)
| Article Name: | Anti-RNASE7 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005690 |
| Supplier Catalog Number: | HPA005690 |
| Alternative Catalog Number: | ATA-HPA005690-100,ATA-HPA005690-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | RNASE7 |
| ribonuclease, RNase A family, 7 |
| Anti-RNASE7 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 84659 |
| UniProt: | Q9H1E1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RNASE7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and rNASE7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410028). |
|
|
HPA005690 |
|
|
|
|
|
HPA005690 |
|
|
HPA005690 |
Product Guarantee and Expert Support
