Anti-FOXJ1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA005714
Artikelname: Anti-FOXJ1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA005714
Hersteller Artikelnummer: HPA005714
Alternativnummer: ATA-HPA005714-100,ATA-HPA005714-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FKHL13, HFH-4, HFH4
forkhead box J1
Anti-FOXJ1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 2302
UniProt: Q92949
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FOXJ1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA005714 antibody. Corresponding FOXJ1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemical staining of human endometrium shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemical staining of human liver shows no positivity as expected.
HPA005714
HPA005714
HPA005714