Anti-FOXJ1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA005714
- Images (8)
| Article Name: | Anti-FOXJ1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA005714 |
| Supplier Catalog Number: | HPA005714 |
| Alternative Catalog Number: | ATA-HPA005714-100,ATA-HPA005714-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FKHL13, HFH-4, HFH4 |
| forkhead box J1 |
| Anti-FOXJ1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 2302 |
| UniProt: | Q92949 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOXJ1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA005714 antibody. Corresponding FOXJ1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity as expected. |
|
|
HPA005714 |
|
|
HPA005714 |
|
|
HPA005714 |
Product Guarantee and Expert Support
