Anti-L1CAM
Artikelnummer:
ATA-HPA005830
- Bilder (8)
| Artikelname: | Anti-L1CAM |
| Artikelnummer: | ATA-HPA005830 |
| Hersteller Artikelnummer: | HPA005830 |
| Alternativnummer: | ATA-HPA005830-100,ATA-HPA005830-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1 |
| L1 cell adhesion molecule |
| Anti-L1CAM |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3897 |
| UniProt: | P32004 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | L1CAM |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA005830 antibody. Corresponding L1CAM RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in distal tubules. |
|
|
Immunohistochemical staining of human colon shows moderate positivity in peripheral nerve / ganglion. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA005830-100ul |
|
|
HPA005830-100ul |
|
|
HPA005830-100ul |
Produktgarantie und fachkundiger Support
