Anti-L1CAM
Catalog Number:
ATA-HPA005830
- Images (8)
| Article Name: | Anti-L1CAM |
| Biozol Catalog Number: | ATA-HPA005830 |
| Supplier Catalog Number: | HPA005830 |
| Alternative Catalog Number: | ATA-HPA005830-100,ATA-HPA005830-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1 |
| L1 cell adhesion molecule |
| Anti-L1CAM |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3897 |
| UniProt: | P32004 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | L1CAM |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA005830 antibody. Corresponding L1CAM RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in distal tubules. |
|
|
Immunohistochemical staining of human colon shows moderate positivity in peripheral nerve / ganglion. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA005830-100ul |
|
|
HPA005830-100ul |
|
|
HPA005830-100ul |
Product Guarantee and Expert Support
