Anti-SIRT1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA006295
Artikelname: Anti-SIRT1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA006295
Hersteller Artikelnummer: HPA006295
Alternativnummer: ATA-HPA006295-100,ATA-HPA006295-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SIR2L1
sirtuin 1
Anti-SIRT1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 23411
UniProt: Q96EB6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SIRT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
HPA006295
HPA006295
HPA006295