Anti-SIRT1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA006295
Article Name: Anti-SIRT1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA006295
Supplier Catalog Number: HPA006295
Alternative Catalog Number: ATA-HPA006295-100,ATA-HPA006295-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SIR2L1
sirtuin 1
Anti-SIRT1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 23411
UniProt: Q96EB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SIRT1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
HPA006295
HPA006295
HPA006295