Anti-SIRT1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SIRT1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA006295
• Supplier Catalog Number: HPA006295
• Alternative Catalog Number: ATA-HPA006295-100,ATA-HPA006295-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SIR2L1

Product Description

sirtuin 1

Additional Information

Anti-SIRT1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 23411
• UniProt: Q96EB6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SIRT1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.

HPA006295

HPA006295

HPA006295