Anti-NR2C2

Artikelnummer: ATA-HPA006313
Artikelname: Anti-NR2C2
Artikelnummer: ATA-HPA006313
Hersteller Artikelnummer: HPA006313
Alternativnummer: ATA-HPA006313-100,ATA-HPA006313-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: hTAK1, TAK1, TR2R1, TR4
nuclear receptor subfamily 2, group C, member 2
Anti-NR2C2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 7182
UniProt: P49116
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NR2C2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human endometrium shows nuclear positivity in glandular cells and cels in the endometrial stroma.
Western blot analysis in human cell line HeLa.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006313-100ul
HPA006313-100ul
HPA006313-100ul