Anti-NR2C2

Catalog Number: ATA-HPA006313
Article Name: Anti-NR2C2
Biozol Catalog Number: ATA-HPA006313
Supplier Catalog Number: HPA006313
Alternative Catalog Number: ATA-HPA006313-100,ATA-HPA006313-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: hTAK1, TAK1, TR2R1, TR4
nuclear receptor subfamily 2, group C, member 2
Anti-NR2C2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7182
UniProt: P49116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NR2C2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human endometrium shows nuclear positivity in glandular cells and cels in the endometrial stroma.
Western blot analysis in human cell line HeLa.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006313-100ul
HPA006313-100ul
HPA006313-100ul