Anti-PRKCA
Artikelnummer:
ATA-HPA006563
- Bilder (8)
| Artikelname: | Anti-PRKCA |
| Artikelnummer: | ATA-HPA006563 |
| Hersteller Artikelnummer: | HPA006563 |
| Alternativnummer: | ATA-HPA006563-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PKCA |
| protein kinase C, alpha |
| Anti-PRKCA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5578 |
| UniProt: | P17252 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRKCA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines A-549 and Caco-2 using Anti-PRKCA antibody. Corresponding PRKCA RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-PRKCA antibody HPA006563 (A) shows similar pattern to independent antibody HPA006564 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA006563-100ul |
|
|
HPA006563-100ul |
|
|
HPA006563-100ul |
Produktgarantie und fachkundiger Support
