Anti-PRKCA

Catalog Number: ATA-HPA006563
Article Name: Anti-PRKCA
Biozol Catalog Number: ATA-HPA006563
Supplier Catalog Number: HPA006563
Alternative Catalog Number: ATA-HPA006563-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PKCA
protein kinase C, alpha
Anti-PRKCA
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5578
UniProt: P17252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PRKCA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western blot analysis in human cell lines A-549 and Caco-2 using Anti-PRKCA antibody. Corresponding PRKCA RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis using Anti-PRKCA antibody HPA006563 (A) shows similar pattern to independent antibody HPA006564 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006563-100ul
HPA006563-100ul
HPA006563-100ul