Anti-ZKSCAN1
Artikelnummer:
ATA-HPA006672
- Bilder (7)
| Artikelname: | Anti-ZKSCAN1 |
| Artikelnummer: | ATA-HPA006672 |
| Hersteller Artikelnummer: | HPA006672 |
| Alternativnummer: | ATA-HPA006672-100,ATA-HPA006672-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33 |
| zinc finger with KRAB and SCAN domains 1 |
| Anti-ZKSCAN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7586 |
| UniProt: | P17029 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZKSCAN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear bodies. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
HPA006672-100ul |
|
|
HPA006672-100ul |
|
|
HPA006672 |
|
|
HPA006672-100ul |
Produktgarantie und fachkundiger Support
