Anti-ZKSCAN1
Catalog Number:
ATA-HPA006672
- Images (7)
| Article Name: | Anti-ZKSCAN1 |
| Biozol Catalog Number: | ATA-HPA006672 |
| Supplier Catalog Number: | HPA006672 |
| Alternative Catalog Number: | ATA-HPA006672-100,ATA-HPA006672-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33 |
| zinc finger with KRAB and SCAN domains 1 |
| Anti-ZKSCAN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7586 |
| UniProt: | P17029 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZKSCAN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear bodies. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
HPA006672-100ul |
|
|
HPA006672-100ul |
|
|
HPA006672 |
|
|
HPA006672-100ul |
Product Guarantee and Expert Support
