Anti-ZKSCAN1
Catalog Number:
ATA-HPA006672
| Article Name: |
Anti-ZKSCAN1 |
| Biozol Catalog Number: |
ATA-HPA006672 |
| Supplier Catalog Number: |
HPA006672 |
| Alternative Catalog Number: |
ATA-HPA006672-100,ATA-HPA006672-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, ICC, IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33 |
| zinc finger with KRAB and SCAN domains 1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 mg/ml |
| Isotype: |
IgG |
| NCBI: |
7586 |
| UniProt: |
P17029 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
NLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTR |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
ZKSCAN1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear bodies. |
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells. |
|
Western blot analysis in human cell line SH-SY5Y. |
|
HPA006672-100ul |
|
HPA006672-100ul |
|
HPA006672 |
|
HPA006672-100ul |