Anti-SORT1
Artikelnummer:
ATA-HPA006889
- Bilder (7)
| Artikelname: | Anti-SORT1 |
| Artikelnummer: | ATA-HPA006889 |
| Hersteller Artikelnummer: | HPA006889 |
| Alternativnummer: | ATA-HPA006889-100,ATA-HPA006889-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Gp95, NT3 |
| sortilin 1 |
| Anti-SORT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6272 |
| UniProt: | Q99523 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SORT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and PC-3 using Anti-SORT1 antibody. Corresponding SORT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA006889-100ul |
|
|
|
|
|
HPA006889-100ul |
|
|
HPA006889-100ul |
Produktgarantie und fachkundiger Support
