Anti-SORT1
Catalog Number:
ATA-HPA006889
- Images (7)
| Article Name: | Anti-SORT1 |
| Biozol Catalog Number: | ATA-HPA006889 |
| Supplier Catalog Number: | HPA006889 |
| Alternative Catalog Number: | ATA-HPA006889-100,ATA-HPA006889-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Gp95, NT3 |
| sortilin 1 |
| Anti-SORT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6272 |
| UniProt: | Q99523 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SORT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and PC-3 using Anti-SORT1 antibody. Corresponding SORT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA006889-100ul |
|
|
|
|
|
HPA006889-100ul |
|
|
HPA006889-100ul |
Product Guarantee and Expert Support
