Anti-TTN
Artikelnummer:
ATA-HPA007042
- Bilder (8)
| Artikelname: | Anti-TTN |
| Artikelnummer: | ATA-HPA007042 |
| Hersteller Artikelnummer: | HPA007042 |
| Alternativnummer: | ATA-HPA007042-100,ATA-HPA007042-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CMD1G, CMH9, CMPD4, FLJ32040, LGMD2J, MYLK5, TMD |
| titin |
| Anti-TTN |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 7273 |
| UniProt: | Q8WZ42 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TTN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA007042 antibody. Corresponding TTN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes. |
|
|
HPA007042-100ul |
|
|
HPA007042-100ul |
|
|
HPA007042-100ul |
Produktgarantie und fachkundiger Support
