Anti-TTN
Catalog Number:
ATA-HPA007042
- Images (8)
| Article Name: | Anti-TTN |
| Biozol Catalog Number: | ATA-HPA007042 |
| Supplier Catalog Number: | HPA007042 |
| Alternative Catalog Number: | ATA-HPA007042-100,ATA-HPA007042-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMD1G, CMH9, CMPD4, FLJ32040, LGMD2J, MYLK5, TMD |
| titin |
| Anti-TTN |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 7273 |
| UniProt: | Q8WZ42 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TTN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA007042 antibody. Corresponding TTN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes. |
|
|
HPA007042-100ul |
|
|
HPA007042-100ul |
|
|
HPA007042-100ul |
Product Guarantee and Expert Support
