Anti-TAPBP
Artikelnummer:
ATA-HPA007066
- Bilder (7)
| Artikelname: | Anti-TAPBP |
| Artikelnummer: | ATA-HPA007066 |
| Hersteller Artikelnummer: | HPA007066 |
| Alternativnummer: | ATA-HPA007066-100,ATA-HPA007066-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TAPA |
| TAP binding protein (tapasin) |
| Anti-TAPBP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6892 |
| UniProt: | O15533 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TAPBP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong positivity in endoplasmic reticulum in non - germinal center cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in endoplasmic reticulum in neutrophils. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in endoplasmic reticulum in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak positivity in endoplasmic reticulum in myocytes. |
|
|
HPA007066-100ul |
|
|
HPA007066-100ul |
|
|
HPA007066-100ul |
Produktgarantie und fachkundiger Support
