Anti-TAPBP
Catalog Number:
ATA-HPA007066
- Images (7)
| Article Name: | Anti-TAPBP |
| Biozol Catalog Number: | ATA-HPA007066 |
| Supplier Catalog Number: | HPA007066 |
| Alternative Catalog Number: | ATA-HPA007066-100,ATA-HPA007066-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TAPA |
| TAP binding protein (tapasin) |
| Anti-TAPBP |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 6892 |
| UniProt: | O15533 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TAPBP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human tonsil shows moderate to strong positivity in endoplasmic reticulum in non - germinal center cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in endoplasmic reticulum in neutrophils. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in endoplasmic reticulum in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak positivity in endoplasmic reticulum in myocytes. |
|
|
HPA007066-100ul |
|
|
HPA007066-100ul |
|
|
HPA007066-100ul |
Product Guarantee and Expert Support
