Anti-FLII

Artikelnummer: ATA-HPA007084
Artikelname: Anti-FLII
Artikelnummer: ATA-HPA007084
Hersteller Artikelnummer: HPA007084
Alternativnummer: ATA-HPA007084-100,ATA-HPA007084-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLI, Fli1, FLIL, MGC39265
flightless I homolog (Drosophila)
Anti-FLII
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 2314
UniProt: Q13045
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FLII
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA007084-100ul
HPA007084-100ul
HPA007084-100ul