Anti-FLII Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FLII Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA007084
• Supplier Catalog Number: HPA007084
• Alternative Catalog Number: ATA-HPA007084-100,ATA-HPA007084-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLI, Fli1, FLIL, MGC39265

Product Description

flightless I homolog (Drosophila)

Additional Information

Anti-FLII

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 2314
• UniProt: Q13045
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FLII
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Western blot analysis in human cell line A-549.

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

HPA007084

HPA007084

HPA007084