Anti-FLII Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA007084
Article Name: Anti-FLII Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA007084
Supplier Catalog Number: HPA007084
Alternative Catalog Number: ATA-HPA007084-100,ATA-HPA007084-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLI, Fli1, FLIL, MGC39265
flightless I homolog (Drosophila)
Anti-FLII
Clonality: Polyclonal
Isotype: IgG
NCBI: 2314
UniProt: Q13045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FLII
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA007084
HPA007084
HPA007084