Anti-ALPL
Artikelnummer:
ATA-HPA007105
- Bilder (8)
| Artikelname: | Anti-ALPL |
| Artikelnummer: | ATA-HPA007105 |
| Hersteller Artikelnummer: | HPA007105 |
| Alternativnummer: | ATA-HPA007105-100,ATA-HPA007105-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HOPS, TNSALP |
| alkaline phosphatase, liver/bone/kidney |
| Anti-ALPL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 249 |
| UniProt: | P05186 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ALPL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human adrenal gland, cerebral cortex, colon and testis using Anti-ALPL antibody HPA007105 (A) shows similar protein distribution across tissues to independent antibody HPA008765 (B). |
|
|
Immunohistochemical staining of human testis using Anti-ALPL antibody HPA007105. |
|
|
Immunohistochemical staining of human colon using Anti-ALPL antibody HPA007105. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-ALPL antibody HPA007105. |
|
|
Immunohistochemical staining of human adrenal gland using Anti-ALPL antibody HPA007105. |
|
|
HPA007105-100ul |
|
|
HPA007105-100ul |
|
|
HPA007105-100ul |
Produktgarantie und fachkundiger Support
