Anti-ALPL
Catalog Number:
ATA-HPA007105
- Images (8)
| Article Name: | Anti-ALPL |
| Biozol Catalog Number: | ATA-HPA007105 |
| Supplier Catalog Number: | HPA007105 |
| Alternative Catalog Number: | ATA-HPA007105-100,ATA-HPA007105-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HOPS, TNSALP |
| alkaline phosphatase, liver/bone/kidney |
| Anti-ALPL |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 249 |
| UniProt: | P05186 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ALPL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human adrenal gland, cerebral cortex, colon and testis using Anti-ALPL antibody HPA007105 (A) shows similar protein distribution across tissues to independent antibody HPA008765 (B). |
|
|
Immunohistochemical staining of human testis using Anti-ALPL antibody HPA007105. |
|
|
Immunohistochemical staining of human colon using Anti-ALPL antibody HPA007105. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-ALPL antibody HPA007105. |
|
|
Immunohistochemical staining of human adrenal gland using Anti-ALPL antibody HPA007105. |
|
|
HPA007105-100ul |
|
|
HPA007105-100ul |
|
|
HPA007105-100ul |
Product Guarantee and Expert Support
