Anti-ADGRF4
Artikelnummer:
ATA-HPA007131
- Bilder (8)
| Artikelname: | Anti-ADGRF4 |
| Artikelnummer: | ATA-HPA007131 |
| Hersteller Artikelnummer: | HPA007131 |
| Alternativnummer: | ATA-HPA007131-100,ATA-HPA007131-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ38076, GPR115, PGR18 |
| adhesion G protein-coupled receptor F4 |
| Anti-ADGRF4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 221393 |
| UniProt: | Q8IZF3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDFHGEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGASRLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPFDYACITDMVKSSETTSGNIAFIVELLKNISTDLSDNVTR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ADGRF4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA007131 antibody. Corresponding ADGRF4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in keratinocytes. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA007131-100ul |
|
|
HPA007131-100ul |
|
|
HPA007131-100ul |
Produktgarantie und fachkundiger Support
