Anti-ADGRF4
Catalog Number:
ATA-HPA007131
- Images (8)
| Article Name: | Anti-ADGRF4 |
| Biozol Catalog Number: | ATA-HPA007131 |
| Supplier Catalog Number: | HPA007131 |
| Alternative Catalog Number: | ATA-HPA007131-100,ATA-HPA007131-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ38076, GPR115, PGR18 |
| adhesion G protein-coupled receptor F4 |
| Anti-ADGRF4 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 221393 |
| UniProt: | Q8IZF3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDFHGEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGASRLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPFDYACITDMVKSSETTSGNIAFIVELLKNISTDLSDNVTR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ADGRF4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA007131 antibody. Corresponding ADGRF4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in keratinocytes. |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA007131-100ul |
|
|
HPA007131-100ul |
|
|
HPA007131-100ul |
Product Guarantee and Expert Support
