Anti-PTPRN

Artikelnummer: ATA-HPA007179
Artikelname: Anti-PTPRN
Artikelnummer: ATA-HPA007179
Hersteller Artikelnummer: HPA007179
Alternativnummer: ATA-HPA007179-100,ATA-HPA007179-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IA-2
protein tyrosine phosphatase, receptor type, N
Anti-PTPRN
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 5798
UniProt: Q16849
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTPRN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-PTPRN antibody. Corresponding PTPRN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in medullary cells.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA007179-100ul
HPA007179-100ul
HPA007179-100ul