Anti-PTPRN
Catalog Number:
ATA-HPA007179
- Images (7)
| Article Name: | Anti-PTPRN |
| Biozol Catalog Number: | ATA-HPA007179 |
| Supplier Catalog Number: | HPA007179 |
| Alternative Catalog Number: | ATA-HPA007179-100,ATA-HPA007179-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IA-2 |
| protein tyrosine phosphatase, receptor type, N |
| Anti-PTPRN |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 5798 |
| UniProt: | Q16849 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTPRN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-PTPRN antibody. Corresponding PTPRN RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in medullary cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA007179-100ul |
|
|
HPA007179-100ul |
|
|
HPA007179-100ul |
Product Guarantee and Expert Support
