Anti-SPINK4

Artikelnummer: ATA-HPA007286
Artikelname: Anti-SPINK4
Artikelnummer: ATA-HPA007286
Hersteller Artikelnummer: HPA007286
Alternativnummer: ATA-HPA007286-100,ATA-HPA007286-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC133107, PEC-60
serine peptidase inhibitor, Kazal type 4
Anti-SPINK4
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 27290
UniProt: O60575
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPINK4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line HeLa shows localization to nucleus, the Golgi apparatus & vesicles.
Immunohistochemistry analysis in human rectum and liver tissues using Anti-SPINK4 antibody. Corresponding SPINK4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human rectum shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA007286-100ul
HPA007286-100ul
HPA007286-100ul