Anti-SPINK4
Catalog Number:
ATA-HPA007286
- Images (8)
| Article Name: | Anti-SPINK4 |
| Biozol Catalog Number: | ATA-HPA007286 |
| Supplier Catalog Number: | HPA007286 |
| Alternative Catalog Number: | ATA-HPA007286-100,ATA-HPA007286-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC133107, PEC-60 |
| serine peptidase inhibitor, Kazal type 4 |
| Anti-SPINK4 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 27290 |
| UniProt: | O60575 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SPINK4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line HeLa shows localization to nucleus, the Golgi apparatus & vesicles. |
|
|
Immunohistochemistry analysis in human rectum and liver tissues using Anti-SPINK4 antibody. Corresponding SPINK4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human rectum shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA007286-100ul |
|
|
|
|
|
HPA007286-100ul |
|
|
HPA007286-100ul |
Product Guarantee and Expert Support
