Anti-IL1RL1

Artikelnummer: ATA-HPA007406
Artikelname: Anti-IL1RL1
Artikelnummer: ATA-HPA007406
Hersteller Artikelnummer: HPA007406
Alternativnummer: ATA-HPA007406-100,ATA-HPA007406-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
interleukin 1 receptor-like 1
Anti-IL1RL1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9173
UniProt: Q01638
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IL1RL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human lung shows moderate membranous positivity in pneumocytes.
Western blot analysis in human cell line HEL.
HPA007406-100ul
HPA007406-100ul
HPA007406-100ul